PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.015G099200.1
Common NamePOPTR_0015s11130g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WRKY
Protein Properties Length: 179aa    MW: 20390.8 Da    PI: 9.7872
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.015G099200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.52.8e-3399157159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         ldDgy+WrKYGqK+vk+s+fprsYYrCts+gC+vkk+v+r+++d+ +v++tYeg Hnh+
  Potri.015G099200.1  99 LDDGYRWRKYGQKTVKSSKFPRSYYRCTSTGCNVKKQVQRNSKDEGIVVTTYEGMHNHP 157
                         59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.6E-3484157IPR003657WRKY domain
SuperFamilySSF1182902.35E-2991158IPR003657WRKY domain
PROSITE profilePS5081131.26194159IPR003657WRKY domain
SMARTSM007748.0E-3899158IPR003657WRKY domain
PfamPF031065.4E-27100157IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MPMEKYQIFL PVSGPSSPSV SPSSLNMANP LIYFHGDSEN GVKPESRFQH LDAKSSVSQT  60
SRICNGSEFK VKPGKRGGDS DDFRKHRYAF QTRSQVDILD DGYRWRKYGQ KTVKSSKFPR  120
SYYRCTSTGC NVKKQVQRNS KDEGIVVTTY EGMHNHPTER SSENFEDILR QIQTYTPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-2889156774Probable WRKY transcription factor 4
2lex_A4e-2889156774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.111830.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1796130.0EF179613.1 (Populus tomentosa x P. bolleana) x P. tomentosa putative WRKY transcription factor 01 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322274.11e-132hypothetical protein POPTR_0015s11130g
SwissprotQ9FYA27e-49WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLB9IFE41e-132B9IFE4_POPTR; Uncharacterized protein
STRINGPOPTR_0015s11130.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.19e-50WRKY DNA-binding protein 75